- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for UBE2N Antibody (OAAL00349) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 4C11-G11 |
Isotype | IgG1 kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | UBE2N (AAH03365, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | UBE2N |
---|---|
Gene Full Name | ubiquitin conjugating enzyme E2 N |
Alias Symbols | bendless-like ubiquitin conjugating enzyme;E2 ubiquitin-conjugating enzyme N;epididymis secretory protein Li 71;HEL-S-71;UBC13;UbcH13;UbcH-ben;UBCHBEN; UBC13;ubiquitin carrier protein N;ubiquitin conjugating enzyme E2N;ubiquitin-conjugating enzyme E2 N;ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13);ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast);ubiquitin-protein ligase N;yeast UBC13 homolog. |
NCBI Gene Id | 7334 |
Protein Name | Homo sapiens ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), mRNA (cDNA clone MGC:5063 IMAGE:2900313), complete cds|Ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) [Homo sapiens] |
Description of Target | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair. [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH03365 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC003365 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "UBE2N Antibody (OAAL00349)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "UBE2N Antibody (OAAL00349)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "UBE2N Antibody (OAAL00349)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "UBE2N Antibody (OAAL00349)"?
This target may also be called "bendless-like ubiquitin conjugating enzyme;E2 ubiquitin-conjugating enzyme N;epididymis secretory protein Li 71;HEL-S-71;UBC13;UbcH13;UbcH-ben;UBCHBEN; UBC13;ubiquitin carrier protein N;ubiquitin conjugating enzyme E2N;ubiquitin-conjugating enzyme E2 N;ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13);ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast);ubiquitin-protein ligase N;yeast UBC13 homolog." in publications.
-
What is the shipping cost for "UBE2N Antibody (OAAL00349)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "UBE2N Antibody (OAAL00349)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "UBE2N Antibody (OAAL00349)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "UBE2N Antibody (OAAL00349)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "UBE2N"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "UBE2N"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "UBE2N"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "UBE2N"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "UBE2N"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "UBE2N"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.