UBE2N Antibody - middlel region (ARP90265_P050)

Catalog No: ARP90265_P050

Host: Rabbit
Target Name: UBE2N
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse UBE2N
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: IRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UBE2N (ARP90265_P050) antibody is Catalog # AAP90265

Target Info

• Gene Symbol: UBE2N
• Gene Full Name: ubiquitin-conjugating enzyme E2N
• Alias Symbols: UBC13, AL022654, BB101821, 1500026J17Rik
• NCBI Gene Id: 93765
• Protein Name: ubiquitin-conjugating enzyme E2 N
• Description of Target: The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains (PubMed:22424771, PubMed:28039360). This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes.
• Uniprot ID: P61089
• Protein Accession #: NP_542127.1
• Nucleotide Accession #: NM_080560.3
• Protein Size (# AA): 152
• Molecular Weight: 16 kDa