UBE2D2B Antibody - C-terminal region (ARP96688_P050)

Catalog No: ARP96688_P050

Host: Rabbit
Target Name: UBE2D2B
Sample Tissue: Mouse Heart lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse UBE2D2B
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UBE2D2B (ARP96688_P050) antibody is Catalog # AAP96688

Target Info

• Gene Symbol: UBE2D2B
• Gene Full Name: ubiquitin-conjugating enzyme E2D 2B
• Alias Symbols: 1700013N18Rik
• NCBI Gene Id: 73318
• Protein Name: ubiquitin-conjugating enzyme E2 D2B
• Description of Target: Catalyzes the covalent attachment of ubiquitin to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection (By similarity). Plays a role in early maturation of the testis.
• Uniprot ID: Q6ZWY6
• Protein Accession #: NP_001263326.1
• Nucleotide Accession #: NM_001276397.1
• Protein Size (# AA): 147
• Molecular Weight: 17 kDa