Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP43008_T100
Price: $0.00
SKU
ARP43008_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-UBE2D2 (ARP43008_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human UBE2D2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE
Concentration1.0 mg/ml
Blocking PeptideFor anti-UBE2D2 (ARP43008_T100) antibody is Catalog # AAP42504 (Previous Catalog # AAPS13006)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceDesforges,M., Am. J. Physiol., Cell Physiol. 290 (1), C305-C312 (2006)
Gene SymbolUBE2D2
Gene Full NameUbiquitin-conjugating enzyme E2D 2
Alias SymbolsUBC4, PUBC1, UBCH4, UBC4/5, UBCH5B, E2(17)KB2
NCBI Gene Id7322
Protein NameUbiquitin-conjugating enzyme E2 D2
Description of TargetThe modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent (Hatanaka et al., 2001).[supplied by OMIM].
Uniprot IDP62837
Protein Accession #NP_003330
Nucleotide Accession #NM_018018
Protein Size (# AA)147
Molecular Weight17 kDa
Protein InteractionsRNF26; CHFR; RBX1; DZIP3; UBA1; UBC; TRAF6; BIRC7; anapc11; ZNRF1; RNF146; MID1; MDM2; BIRC3; FZR1; ITCH; HRD1; CUL3; XIAP; MARCH7; RNF25; UBE2D2; RNF130; UBA6; CBLC; PARK2; TRIM21; KCMF1; RNF135; MUL1; MDM4; TRIM23; STUB1; CBL; UBTD1; RNF38; UBI4; RFFL;
  1. What is the species homology for "UBE2D2 Antibody - middle region (ARP43008_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "UBE2D2 Antibody - middle region (ARP43008_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UBE2D2 Antibody - middle region (ARP43008_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UBE2D2 Antibody - middle region (ARP43008_T100)"?

    This target may also be called "UBC4, PUBC1, UBCH4, UBC4/5, UBCH5B, E2(17)KB2" in publications.

  5. What is the shipping cost for "UBE2D2 Antibody - middle region (ARP43008_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UBE2D2 Antibody - middle region (ARP43008_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UBE2D2 Antibody - middle region (ARP43008_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UBE2D2 Antibody - middle region (ARP43008_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "UBE2D2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UBE2D2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UBE2D2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UBE2D2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UBE2D2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UBE2D2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UBE2D2 Antibody - middle region (ARP43008_T100)
Your Rating
We found other products you might like!