- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-UBE2C (ARP43473_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE2C |
Purification | Affinity purified |
Predicted Homology Based on Immunogen Sequence | Human: 100% |
Peptide Sequence | Synthetic peptide located within the following region: SAFPESDNLFKWVGTIHGAAGTAVGSIRTSSTVCLLSGPRETQDSSKPLV |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-UBE2C (ARP43473_P050-FITC) antibody is Catalog # AAP43473 |
Gene Symbol | UBE2C |
---|---|
Gene Full Name | ubiquitin conjugating enzyme E2C |
Alias Symbols | UBCH10, dJ447F3.2 |
NCBI Gene Id | 11065 |
Protein Name | ubiquitin-conjugating enzyme E2 C |
Description of Target | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. |
Uniprot ID | O00762-4 |
Protein Accession # | NP_861515 |
Nucleotide Accession # | NM_001281741.1 |
Protein Size (# AA) | 161 |
Molecular Weight | 17 kDa |
Protein Interactions | ANAPC11; FZR1; KLHL2; UBE2C; PCGF3; UBC; MAPK7; UBA1; BAG3; TNNC1; CXCR1; Rag1; TTC9C; UNK; ZFYVE19; UBQLN4; UBXN1; UBQLN1; UBXN7; TTLL12; SEC24A; AHCYL1; SSSCA1; YAP1; UBE4B; USP34; ZRANB2; ATP6V1F; USP9X; UBE2V1; UBE2B; TYMS; TRIP6; PSMC6; PSMA5; PPM1G; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "UBE2C Antibody - middle region : FITC (ARP43473_P050-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "UBE2C Antibody - middle region : FITC (ARP43473_P050-FITC)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
-
What buffer format is "UBE2C Antibody - middle region : FITC (ARP43473_P050-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "UBE2C Antibody - middle region : FITC (ARP43473_P050-FITC)"?
This target may also be called "UBCH10, dJ447F3.2" in publications.
-
What is the shipping cost for "UBE2C Antibody - middle region : FITC (ARP43473_P050-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "UBE2C Antibody - middle region : FITC (ARP43473_P050-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "UBE2C Antibody - middle region : FITC (ARP43473_P050-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "17 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "UBE2C Antibody - middle region : FITC (ARP43473_P050-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "UBE2C"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "UBE2C"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "UBE2C"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "UBE2C"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "UBE2C"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "UBE2C"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.