UBCD6 Recombinant Protein (Fruit fly) (OPCA02043)

Catalog No: OPCA02043

UbcD6 Recombinant Protein (Drosophila melanogaster) (OPCA02043) in SDS-PAGE showing the molecular weight of approximately 33.15 kDa.

Product Info

• Predicted Species Reactivity: Drosophila melanogaster
• Product Format: Liquid or Lyophilized powder
• Host: Drosophila melanogaster
• Additional Information: Relevance: Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID
• Protein Sequence: MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-151 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Dhr6, a Drosophila homolog of the yeast DNA-repair gene RAD6.Koken M.H.M., Reynolds P., Bootsma D., Hoeijmakers J.H.J., Prakash S., Prakash L.Proc. Natl. Acad. Sci. U.S.A. 88:3832-3836(1991)
• Gene Symbol: Ubc6
• Gene Full Name: Ubiquitin conjugating enzyme 6
• Alias Symbols: BcDNA:RE56673;CG2013;CG2013-PA;CG2013-PC;Dhr6;Dmel\CG2013;Dmel_CG2013;dRAD6;E2 ubiquitin-conjugating enzyme 6;RAD6;Rad6a;UBC6;Ubc6-PA;Ubc6-PC;UbcD6;Ubiquitin carrier protein;ubiquitin conjugating enzyme;ubiquitin conjugating enzyme 6;Ubiquitin-protein ligase.
• NCBI Gene Id: 40610
• Protein Name: Ubiquitin-conjugating enzyme E2-17 kDa
• Description of Target: Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA (PubMed:1902572). Involved in the negative regulation of the Ras/MAPK signaling pathway in the wing by acting with the putative E3 ligases poe, Kcmf1 and Ufd4 to mediate the ubiquitination and proteasomal degradation of rl/MAPK (PubMed:27552662).
• Uniprot ID: P25153
• Protein Accession #: NP_001246916.1
  
• Nucleotide Accession #: NM_001259987.3
• Protein Size (# AA): Recombinant
• Molecular Weight: 33.2 kDa