Size:100 ug
$315.00
In Stock
SKU
OAAL00865
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.
More Information
Predicted Species Reactivity Human
Product Format Liquid
Clonality Monoclonal
Clone 3G7
Isotype IgG2b Kappa
Host Mouse
Application IHC, IF
Reconstitution and Storage Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Replacement Item This antibody may replace item sc-366263 from Santa Cruz Biotechnology.
Immunogen UBASH3B (NP_116262.2, 344 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Peptide Sequence Synthetic peptide located within the following region: DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI
Datasheets/Manuals Printable datasheet for anti-UBASH3B (OAAL00865) antibody
Formulation In 1x PBS, pH 7.4
Gene Symbol UBASH3B
Official Gene Full Name ubiquitin associated and SH3 domain containing, B
Alias Symbols KIAA1959, MGC15437, STS-1, STS1, p70
NCBI Gene Id 84959
Description of Target This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. [provided by RefSeq
Protein Accession # NP_116262.2
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express UBASH3B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express UBASH3B.
  1. What is the species homology for "UBASH3B Antibody (OAAL00865)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "UBASH3B Antibody (OAAL00865)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "UBASH3B Antibody (OAAL00865)" provided in?

    This item is provided in "Liquid".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UBASH3B Antibody (OAAL00865)"?

    This target may also be called "KIAA1959, MGC15437, STS-1, STS1, p70" in publications.

  5. What is the shipping cost for "UBASH3B Antibody (OAAL00865)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UBASH3B Antibody (OAAL00865)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UBASH3B Antibody (OAAL00865)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UBASH3B Antibody (OAAL00865)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "UBASH3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UBASH3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UBASH3B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UBASH3B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UBASH3B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UBASH3B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UBASH3B Antibody (OAAL00865)
Your Rating