Search Antibody, Protein, and ELISA Kit Solutions

UBASH3B Antibody (OAAL00865)

100 ug
$315.00
In Stock
Request Bulk Order Quote

Gene Symbol:
UBASH3B
NCBI Gene Id:
84959
Official Gene Full Name:
ubiquitin associated and SH3 domain containing, B
Protein Accession #:
NP_116262.2
Alias Symbols:
KIAA1959, MGC15437, STS-1, STS1, p70
Replacement Item:
This antibody may replace item sc-366263 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. [provided by RefSeq
Host:
Mouse
Clonality:
Monoclonal
Application:
IHC, IF, ELISA
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UBASH3B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UBASH3B.
Immunogen:
UBASH3B (NP_116262.2, 344 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI
Product Format:
Liquid
Reconstitution and Storage:
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Datasheets/Manuals:
Printable datasheet for anti-UBASH3B (OAAL00865) antibody
Formulation:
In 1x PBS, pH 7.4
Clone:
3G7
Isotype:
IgG2b Kappa

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...