- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for UBASH3B Antibody (OAAL00865) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 3G7 |
| Isotype | IgG2b Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | UBASH3B (NP_116262.2, 344 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | UBASH3B |
|---|---|
| Gene Full Name | ubiquitin associated and SH3 domain containing B |
| Alias Symbols | cbl-interacting protein p70;Cbl-interacting protein Sts-1;nm23-phosphorylated unknown substrate;p70;SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling 1, nm23-phosphorylated unknown substrate;STS1;STS-1;suppressor of T-cell receptor signaling 1;T-cell ubiquitin ligand 2;TULA2;TULA-2;tyrosine-protein phosphatase STS1/TULA2;ubiquitin-associated and SH3 domain-containing protein B. |
| NCBI Gene Id | 84959 |
| Protein Name | Homo sapiens ubiquitin associated and SH3 domain containing B (UBASH3B), mRNA|ubiquitin-associated and SH3 domain-containing protein B [Homo sapiens] |
| Description of Target | This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_116262.2 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_032873 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "UBASH3B Antibody (OAAL00865)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "UBASH3B Antibody (OAAL00865)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "UBASH3B Antibody (OAAL00865)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "UBASH3B Antibody (OAAL00865)"?
This target may also be called "cbl-interacting protein p70;Cbl-interacting protein Sts-1;nm23-phosphorylated unknown substrate;p70;SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling 1, nm23-phosphorylated unknown substrate;STS1;STS-1;suppressor of T-cell receptor signaling 1;T-cell ubiquitin ligand 2;TULA2;TULA-2;tyrosine-protein phosphatase STS1/TULA2;ubiquitin-associated and SH3 domain-containing protein B." in publications.
-
What is the shipping cost for "UBASH3B Antibody (OAAL00865)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "UBASH3B Antibody (OAAL00865)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "UBASH3B Antibody (OAAL00865)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "UBASH3B Antibody (OAAL00865)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "UBASH3B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "UBASH3B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "UBASH3B"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "UBASH3B"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "UBASH3B"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "UBASH3B"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
