Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP50493_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP50493_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-UBA3 (ARP50493_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human UBA3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCEL
Concentration0.5 mg/ml
Blocking PeptideFor anti-UBA3 (ARP50493_P050-FITC) antibody is Catalog # AAP50493 (Previous Catalog # AAPP29786)
ReferenceLi,T., (2006) Arch. Biochem. Biophys. 453 (1), 70-74
Gene SymbolUBA3
Gene Full NameUbiquitin-like modifier activating enzyme 3
Alias SymbolsNAE2, UBE1C, hUBA3
NCBI Gene Id9039
Protein NameNEDD8-activating enzyme E1 catalytic subunit
Description of TargetUBA3 is a catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. UBA3 down-regulates steroid receptor activity. UBA3 is necessary for cell cycle progression.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Uniprot IDQ8TBC4
Protein Accession #NP_003959
Nucleotide Accession #NM_003968
Protein Size (# AA)463
Molecular Weight52kDa
Protein InteractionsUBA3; UBC; IMPA2; CPNE2; NEDD8; CAMK1D; NSFL1C; DCPS; KDM1A; PAPSS1; NAE1; XPO1; PCYT2; CAPN2; AHCY; ACAT2; NT5DC1; NUDCD2; TXNDC17; WDR61; UFC1; DSTN; VCL; UBE2H; PRDX2; TWF1; UBE2M; UIMC1; CHD3;
  1. What is the species homology for "UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)"?

    This target may also be called "NAE2, UBE1C, hUBA3" in publications.

  5. What is the shipping cost for "UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "UBA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UBA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UBA3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UBA3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UBA3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UBA3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UBA3 Antibody - N-terminal region : FITC (ARP50493_P050-FITC)
Your Rating
We found other products you might like!