UACA Antibody - C-terminal region (ARP62098_P050)

Catalog No: ARP62098_P050

WB Suggested Anti-UACA Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 85%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: TELLNDVERLKQALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UACA (ARP62098_P050) antibody is Catalog # AAP62098 (Previous Catalog # AAPP48417)

Target Info

• Gene Symbol: UACA
• Gene Full Name: Uveal autoantigen with coiled-coil domains and ankyrin repeats
• Alias Symbols: NUCLING
• NCBI Gene Id: 55075
• Protein Name: Uveal autoantigen with coiled-coil domains and ankyrin repeats
• Description of Target: UACA regulates APAF1 expression and plays an important role in the regulation of stress-induced apoptosis. It promotes apoptosis by regulating three pathways, apoptosome up-regulation, LGALS3/galectin-3 down-regulation and NF-kappa-B inactivation. It regulates the redistribution of APAF1 into the nucleus after proapoptotic stress and down-regulates the expression of LGALS3 by inhibiting NFKB1.
• Uniprot ID: Q9BZF9
• Protein Accession #: NP_001008225
• Nucleotide Accession #: NM_001008224
• Protein Size (# AA): 1403
• Molecular Weight: 154kDa
• Protein Interactions: KRT40; FUS; RNF2; HIF1AN; PAN2; TP63; UBC; USP48; RABEP1; STAMBP; FBXO25; NRD1; Mprip; MED14; CELSR3;