Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP40285_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40285_P050-FITC Conjugated

ARP40285_P050-HRP Conjugated

ARP40285_P050-Biotin Conjugated

U2AF2 Antibody - C-terminal region (ARP40285_P050)

Rating:
80% of 100
Catalog#: ARP40285_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human U2AF2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Complete computational species homology data Anti-U2AF2 (ARP40285_P050)
Peptide Sequence Synthetic peptide located within the following region: TEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-U2AF2 (ARP40285_P050) antibody is Catalog # AAP40285
Datasheets/Manuals Printable datasheet for anti-U2AF2 (ARP40285_P050) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that U2AF2 is expressed in HepG2

Gene Symbol U2AF2
Official Gene Full Name U2 small nuclear RNA auxiliary factor 2
Alias Symbols U2AF65
NCBI Gene Id 11338
Protein Name U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2, isoform CRA_a EMBL EDL31286.1
Description of Target U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. U2AF2 is the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly.
Swissprot Id Q80XR5
Protein Accession # NP_001012496
Nucleotide Accession # NM_001012478
Protein Size (# AA) 471
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express U2AF2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express U2AF2.
Protein Interactions THAP1; PUF60; U2AF1; SNRPA; AES; DACH1; SUMO3; UBC; SUZ12; EED; TERF1; EZH2; RNF2; PRPF40A; TCERG1; APBB1; PIN1; SH3RF2; SRPK2; SRPK1; SF1; SRSF1; RBM39; QKI; SCAF11; PRPF3; RBM10; RBM4; SMAD5; IL7R; HNRNPK; HNRNPD; HLA-DMA; SUGP1; CCAR1; SAP30BP; RBFOX2;
  1. What is the species homology for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "U2AF2 Antibody - C-terminal region (ARP40285_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?

    This target may also be called "U2AF65" in publications.

  5. What is the shipping cost for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "U2AF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "U2AF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "U2AF2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "U2AF2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "U2AF2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "U2AF2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:U2AF2 Antibody - C-terminal region (ARP40285_P050)
Your Rating
We found other products you might like!