Search Antibody, Protein, and ELISA Kit Solutions

U2AF2 Antibody - C-terminal region (ARP40285_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40285_P050-FITC Conjugated

ARP40285_P050-HRP Conjugated

ARP40285_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
U2AF2
Official Gene Full Name:
U2 small nuclear RNA auxiliary factor 2
NCBI Gene Id:
11338
Protein Name:
U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2, isoform CRA_a EMBL EDL31286.1
Swissprot Id:
Q80XR5
Protein Accession #:
NP_001012496
Nucleotide Accession #:
NM_001012478
Alias Symbols:
U2AF65
Description of Target:
U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. U2AF2 is the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly.
Protein Size (# AA):
471
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express U2AF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express U2AF2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human U2AF2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Complete computational species homology data:
Anti-U2AF2 (ARP40285_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
THAP1; PUF60; U2AF1; SNRPA; AES; DACH1; SUMO3; UBC; SUZ12; EED; TERF1; EZH2; RNF2; PRPF40A; TCERG1; APBB1; PIN1; SH3RF2; SRPK2; SRPK1; SF1; SRSF1; RBM39; QKI; SCAF11; PRPF3; RBM10; RBM4; SMAD5; IL7R; HNRNPK; HNRNPD; HLA-DMA; SUGP1; CCAR1; SAP30BP; RBFOX2;
Blocking Peptide:
For anti-U2AF2 (ARP40285_P050) antibody is Catalog # AAP40285
Datasheets/Manuals:
Printable datasheet for anti-U2AF2 (ARP40285_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that U2AF2 is expressed in HepG2

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

92/04/2019 06:40
  • Overall Experience:
  • Quality:
Human Fibroblasts in WB

Submitted by:
Maja Dembic
Syddansk Universitet

U2AF2

Host: Rabbit

Sample type: Human fibroblasts; nuclear extracts.

Lane 1: 10ug fibroblast protein extract

Lane 2: 10ug nuclear extract

Lane 3: 20ug nuclear extract

Primary antibody dilution: 1:1000 O.N. at 4°C.

Secondary antibody and dilution: 

Goat anti-mouse IgG-HRP; 1:10 000.

Goat anti-rabbit IgG-HRP; 1:15 000.

Protocol: Various samples were run and separated on a Bis-Tris 4-12% gradient gel in MOPS 1x buffer, under denaturing conditions. The samples were transferred on PVDF membrane (30V constant;1h, 30 min) and blotted with the antibodies. After blocking for aspecific binding all primary antibodies were incubated O.N., at 4 degrees. Washing and secondary antibody staining was performed on SNAP i.d 2.0 Protein Detection System, Millipore, according to instructions. After incubation with ECL, the membranes were exposed for a maximum of 10 minutes.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...