Catalog No: OPCA04500
Price: $0.00
SKU
OPCA04500
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
U1-CYRTAUTOXIN-AS1C Recombinant Protein (Apomastus schlingeri ) (OPCA04500)
Datasheets/Manuals | Printable datasheet for U1-CYRTAUTOXIN-AS1C Recombinant Protein (Apomastus schlingeri ) (OPCA04500) (OPCA04500) |
---|
Predicted Species Reactivity | Apomastus schlingeri |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Apomastus schlingeri |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC |
Protein Sequence | EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-76 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Identification of insecticidal peptides from venom of the trap-door spider, Aptostichus schlingeri (Ctenizidae).Skinner W.S., Dennis P.A., Li J.P., Quistad G.B.Toxicon 30:1043-1050(1992) |
Alias Symbols | Aptotoxin VI;Aptotoxin-6;Paralytic peptide VI. |
---|---|
Protein Name | U1-cyrtautoxin-As1c |
Description of Target | Insecticidal peptide that causes a rapid, irreversible flaccid paralysis that results in death. |
Uniprot ID | P49270 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 12.3 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review