Search Antibody, Protein, and ELISA Kit Solutions

TYW1 Antibody - C-terminal region (ARP85738_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
TYW1
Official Gene Full Name:
tRNA-yW synthesizing protein 1 homolog
NCBI Gene Id:
55253
Protein Name:
S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase
Swissprot Id:
Q6NUM6-2
Protein Accession #:
NP_060734.2
Nucleotide Accession #:
NM_018264.3
Alias Symbols:
TYW1A, RSAFD1, YPL207W
Description of Target:
Wybutosine (yW) is a hypermodified guanosine found in phenylalanine tRNA adjacent to the anticodon that stabilizes codon-anticodon interactions in the ribosome. In yeast, the homolog of this gene is essential for the synthesis of wybutosine. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
294
Molecular Weight:
34 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TYW1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TYW1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TYW1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRHQRKNKSKAIS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TYW1 (ARP85738_P050) antibody is Catalog # AAP85738
Datasheets/Manuals:
Printable datasheet for anti-TYW1 (ARP85738_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...