Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP85738_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

TYW1 Antibody - C-terminal region (ARP85738_P050)

Catalog#: ARP85738_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TYW1
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: EYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRHQRKNKSKAIS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TYW1 (ARP85738_P050) antibody is Catalog # AAP85738
Datasheets/Manuals Printable datasheet for anti-TYW1 (ARP85738_P050) antibody
Gene Symbol TYW1
Official Gene Full Name tRNA-yW synthesizing protein 1 homolog
Alias Symbols TYW1A, RSAFD1, YPL207W
NCBI Gene Id 55253
Protein Name S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase
Description of Target Wybutosine (yW) is a hypermodified guanosine found in phenylalanine tRNA adjacent to the anticodon that stabilizes codon-anticodon interactions in the ribosome. In yeast, the homolog of this gene is essential for the synthesis of wybutosine. Alternative splicing results in multiple transcript variants.
Swissprot Id Q6NUM6-2
Protein Accession # NP_060734.2
Nucleotide Accession # NM_018264.3
Protein Size (# AA) 294
Molecular Weight 34 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TYW1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TYW1.
  1. What is the species homology for "TYW1 Antibody - C-terminal region (ARP85738_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "TYW1 Antibody - C-terminal region (ARP85738_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "TYW1 Antibody - C-terminal region (ARP85738_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TYW1 Antibody - C-terminal region (ARP85738_P050)"?

    This target may also be called "TYW1A, RSAFD1, YPL207W" in publications.

  5. What is the shipping cost for "TYW1 Antibody - C-terminal region (ARP85738_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TYW1 Antibody - C-terminal region (ARP85738_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TYW1 Antibody - C-terminal region (ARP85738_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TYW1 Antibody - C-terminal region (ARP85738_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TYW1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TYW1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TYW1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TYW1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TYW1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TYW1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TYW1 Antibody - C-terminal region (ARP85738_P050)
Your Rating
We found other products you might like!