Search Antibody, Protein, and ELISA Kit Solutions

TYMP Antibody - N-terminal region : FITC (ARP76106_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76106_P050 Unconjugated

ARP76106_P050-HRP Conjugated

ARP76106_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TYMP
Official Gene Full Name:
thymidine phosphorylase
NCBI Gene Id:
1890
Protein Name:
thymidine phosphorylase
Swissprot Id:
P19971
Protein Accession #:
NP_001944
Alias Symbols:
TP, ECGF, ECGF1, MNGIE, MEDPS1, MTDPS1, PDECGF, hPD-ECGF
Description of Target:
This gene encodes an angiogenic factor which promotes angiogenesis in vivo and stimulates the in vitro growth of a variety of endothelial cells. It has a highly restricted target cell specificity acting only on endothelial cells. Mutations in this gene have been associated with mitochondrial neurogastrointestinal encephalomyopathy. Multiple alternatively spliced transcript variants have been identified.
Protein Size (# AA):
482
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TYMP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TYMP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TYPH
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: GEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-TYMP (ARP76106_P050-FITC) antibody is Catalog # AAP76106
Datasheets/Manuals:
Printable datasheet for anti-TYMP (ARP76106_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...