TXNRD1 Antibody - middle region (ARP97491_P050)

Catalog No: ARP97491_P050

Host: Rabbit
Target Name: TXNRD1
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXNRD1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TXNRD1 (ARP97491_P050) antibody is Catalog # AAP97491

Target Info

• Gene Symbol: TXNRD1
• Gene Full Name: thioredoxin reductase 1
• Alias Symbols: TR, TR1, TXNR, TRXR1, GRIM-12
• NCBI Gene Id: 7296
• Protein Name: thioredoxin reductase 1, cytoplasmic
• Description of Target: The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis.
• Uniprot ID: Q16881-5
• Protein Accession #: NP_001087240.1
• Nucleotide Accession #: NM_001093771.2
• Protein Size (# AA): 499
• Molecular Weight: 54 kDa