- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for TXNL4A Antibody (OAAL00546) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 1C4 |
Isotype | IgG1 kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | TXNL4A (AAH01046, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | TXNL4A |
---|---|
Gene Full Name | thioredoxin like 4A |
Alias Symbols | BMKS;DIB1;DIM1;DIM1 protein homolog;SNRNP15;spliceosomal U5 snRNP-specific 15 kDa protein;thioredoxin-like 4;thioredoxin-like protein 4A;thioredoxin-like U5 snRNP protein U5-15kD;TXNL4;U5-15kD. |
NCBI Gene Id | 10907 |
Protein Name | Homo sapiens thioredoxin-like 4A, mRNA (cDNA clone MGC:1296 IMAGE:2823293), complete cds|Thioredoxin-like 4A [Homo sapiens] |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH01046 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC001046 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TXNL4A Antibody (OAAL00546)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "TXNL4A Antibody (OAAL00546)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "TXNL4A Antibody (OAAL00546)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TXNL4A Antibody (OAAL00546)"?
This target may also be called "BMKS;DIB1;DIM1;DIM1 protein homolog;SNRNP15;spliceosomal U5 snRNP-specific 15 kDa protein;thioredoxin-like 4;thioredoxin-like protein 4A;thioredoxin-like U5 snRNP protein U5-15kD;TXNL4;U5-15kD." in publications.
-
What is the shipping cost for "TXNL4A Antibody (OAAL00546)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TXNL4A Antibody (OAAL00546)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TXNL4A Antibody (OAAL00546)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TXNL4A Antibody (OAAL00546)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TXNL4A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TXNL4A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TXNL4A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TXNL4A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TXNL4A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TXNL4A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.