Search Antibody, Protein, and ELISA Kit Solutions

TUSC4 antibody - N-terminal region (ARP50539_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP50539_P050-FITC Conjugated

ARP50539_P050-HRP Conjugated

ARP50539_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Nitrogen permease regulator-like 2 (S. cerevisiae)
Protein Name:
Nitrogen permease regulator 2-like protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
TUSC4 suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. TUSC4 down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. TUSC4 may act as a tumor suppressor. TUSC4 suppresses cell growth and enhanced sensitivity to various anticancer drugs.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TUSC4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TUSC4.
The immunogen is a synthetic peptide directed towards the N terminal region of human TUSC4
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-TUSC4 (ARP50539_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NPRL2 (ARP50539_P050) antibody is Catalog # AAP50539 (Previous Catalog # AAPY02471)
Printable datasheet for anti-NPRL2 (ARP50539_P050) antibody
Sample Type Confirmation:

NPRL2 is supported by BioGPS gene expression data to be expressed in OVCAR3

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...