TULP2 Antibody - middle region (ARP33472_P050)

Catalog No: ARP33472_P050

WB Suggested Anti-TULP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Thymus

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TULP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 80%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: RKRRRSKTSNYLISLDPTLLSRDGDNFVGKVRSNVFSTKFTIFDNGVNPD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TULP2 (ARP33472_P050) antibody is Catalog # AAP33472 (Previous Catalog # AAPP04522)
• Reference: North,M.A., (1997) Proc. Natl. Acad. Sci. U.S.A. 94 (7), 3128-3133

Target Info

• Gene Symbol: TULP2
• Gene Full Name: Tubby like protein 2
• Alias Symbols: CT65, TUBL2
• NCBI Gene Id: 7288
• Protein Name: Tubby-related protein 2
• Description of Target: TULP2 is a member of a family of tubby-like genes (TULPs) that encode proteins of unknown function. Members of this family have been identified in plants, vertebrates, and invertebrates. The TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues. TULP2 is a member of a family of tubby-like genes (TULPs) that encode proteins of unknown function. Members of this family have been identified in plants, vertebrates, and invertebrates. The TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues.
• Uniprot ID: O00295
• Protein Accession #: NP_003314
• Nucleotide Accession #: NM_003323
• Protein Size (# AA): 520
• Molecular Weight: 59kDa
• Protein Interactions: BRCA1; BARD1; ELAVL1; MEOX2; EWSR1;