TULP1 Antibody - middle region (ARP33469_P050)

Catalog No: ARP33469_P050

WB Suggested Anti-TULP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TULP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 91%; Yeast: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TULP1 (ARP33469_P050) antibody is Catalog # AAP33469 (Previous Catalog # AAPP04519)
• Reference: Abbasi,A.H., (er) Mol. Vis. 14, 675-682 (2008)

Target Info

• Gene Symbol: TULP1
• Gene Full Name: Tubby like protein 1
• Alias Symbols: RP14, LCA15, TUBL1
• NCBI Gene Id: 7287
• Protein Name: Tubby-related protein 1
• Description of Target: TULP1 is required for normal development of photoreceptor synapses. TULP1 is also required for normal photoreceptor function and for long-term survival of photoreceptor cells. TULP1 interacts with cytoskeleton proteins and may play a role in protein transport in photoreceptor cells. TULP1 binds lipids, especially phosphatidylinositol-3-phosphate, phosphatidylinositol-4-phosphate, phosphatidylinositol-5-phosphate, phosphatidylinositol-3,4-bisphosphate, phosphatidylinositol-4,5-bisphosphate, phosphatidylinositol-3,4,5-bisphosphate, phosphatidylserine and phosphatidic acid (in vitro).This gene encodes a member of the tubby-like gene family (TULPs). Members of this family have been identified in plants, vertebrates, and invertebrates and encode proteins of unknown function. TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues. Mutations in this gene may be associated with retinitis pigmentosa. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O00294
• Protein Accession #: NP_003313
• Nucleotide Accession #: NM_003322
• Protein Size (# AA): 542
• Molecular Weight: 60kDa