TUFM Antibody - middle region (ARP90950_P050)

Catalog No: ARP90950_P050

Host: Rabbit
Target Name: TUFM
Sample Tissue: Mouse Pancreas lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse TUFM
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: DHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TUFM (ARP90950_P050) antibody is Catalog # AAP90950

Target Info

• Gene Symbol: TUFM
• Gene Full Name: Tu translation elongation factor, mitochondrial
• Alias Symbols: EFTU, C76308, C76389, EF-TuMT, 2300002G02Rik
• NCBI Gene Id: 233870
• Protein Name: elongation factor Tu, mitochondrial
• Description of Target: Promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. Plays also a role in the regulation of autophagy and innate immunity. Recruits ATG5-ATG12 and NLRX1 at mitochondria and serves as a checkpoint of the RIG-I/DDX58-MAVS pathway. In turn, inhibits RLR-mediated type I interferon while promoting autophagy.
• Uniprot ID: Q8BFR5
• Protein Accession #: NP_001157185.1
• Nucleotide Accession #: NM_001163713.1
• Protein Size (# AA): 452
• Molecular Weight: 49 kDa