Loading...
Catalog No: ARP58546_P050
Price: $0.00
SKU
ARP58546_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TUFM (ARP58546_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TUFM
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Yeast: 77%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM
Concentration0.5 mg/ml
Blocking PeptideFor anti-TUFM (ARP58546_P050) antibody is Catalog # AAP58546 (Previous Catalog # AAPP34728)
Sample Type Confirmation

TUFM is supported by BioGPS gene expression data to be expressed in HeLa

ReferenceValente,L., (2007) Am. J. Hum. Genet. 80 (1), 44-58
Publications

Clemente, P. et al. hCOA3 stabilizes cytochrome c oxidase 1 (COX1) and promotes cytochrome c oxidase assembly in human mitochondria. J. Biol. Chem. 288, 8321-31 (2013). 23362268

Gene SymbolTUFM
Gene Full NameTu translation elongation factor, mitochondrial
Alias SymbolsP43, EFTU, COXPD4, EF-TuMT
NCBI Gene Id7284
Protein NameElongation factor Tu, mitochondrial
Description of TargetTUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP49411
Protein Accession #NP_003312
Nucleotide Accession #NM_003321
Protein Size (# AA)455
Molecular Weight50kDa
Protein InteractionsFAM9B; FUNDC1; CMTM5; ARL6IP1; HUWE1; FUS; SUMO2; SUMO3; SPRTN; UBC; MDM2; ASB12; ASB14; ASB10; ASB17; SUZ12; BMI1; RNF2; TUBB2A; XPO1; TUBB6; CAMK1D; NSFL1C; IPO9; UBXN1; DCPS; PROSC; PDIA4; PLAA; GTF3C4; NAE1; PPP5C; PPP1R2; PAFAH1B2; HK1; HEXB; GAPDH;
  1. What is the species homology for "TUFM Antibody - middle region (ARP58546_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "TUFM Antibody - middle region (ARP58546_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TUFM Antibody - middle region (ARP58546_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TUFM Antibody - middle region (ARP58546_P050)"?

    This target may also be called "P43, EFTU, COXPD4, EF-TuMT" in publications.

  5. What is the shipping cost for "TUFM Antibody - middle region (ARP58546_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TUFM Antibody - middle region (ARP58546_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TUFM Antibody - middle region (ARP58546_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TUFM Antibody - middle region (ARP58546_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TUFM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TUFM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TUFM"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TUFM"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TUFM"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TUFM"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TUFM Antibody - middle region (ARP58546_P050)
Your Rating
We found other products you might like!