- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450)
| Datasheets/Manuals | Printable datasheet for Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Additional Information | Modification Sites: Human:T1462 Mouse:T1465 Rat:T1466 |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Tuberin/TSC2 around the phosphorylation site of Thr1462. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: AAWSASGEDSRGQPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVER |
| Concentration | 1mg/ml |
| Specificity | Tuberin/TSC2 (Phospho-Thr1462) Antibody detects endogenous levels of Tuberin/TSC2 only when phosphorylated at Thr1462. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | IHC: 1:50~1:100 ELISA: 1:1000 |
| Gene Symbol | TSC2 |
|---|---|
| Gene Full Name | TSC complex subunit 2 |
| Alias Symbols | LAM;PPP1R160;protein phosphatase 1, regulatory subunit 160;TSC4;tuberin;tuberous sclerosis 2 protein. |
| NCBI Gene Id | 7249 |
| Protein Name | Tuberin |
| Description of Target | In complex with TSC1, this tumor suppressor inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling (PubMed:12271141, PubMed:28215400). Acts as a GTPase-activating protein (GAP) for the small GTPase RHEB, a direct activator of the protein kinase activity of mTORC1 (PubMed:15340059). May also play a role in microtubule-mediated protein transport (By similarity). Also stimulates the intrinsic GTPase activity of the Ras-related proteins RAP1A and RAB5 (By similarity). |
| Uniprot ID | P49815 |
| Molecular Weight | 200 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450)"?
This target may also be called "LAM;PPP1R160;protein phosphatase 1, regulatory subunit 160;TSC4;tuberin;tuberous sclerosis 2 protein." in publications.
-
What is the shipping cost for "Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "200 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Tuberin/TSC2 Antibody (Phospho-Thr1462) (OAAF07450)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TSC2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TSC2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TSC2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TSC2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TSC2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TSC2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
