TUBA3E Antibody - middle region (ARP53516_P050)

Catalog No: ARP53516_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: TBA3E
Sample Type: A549 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Guinea Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBA3E
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 100%; Human: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: RLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TUBA3E (ARP53516_P050) antibody is Catalog # AAP53516
• Reference: N/A

Target Info

• Gene Symbol: TUBA3E
• Gene Full Name: tubulin alpha 3e
• NCBI Gene Id: 112714
• Protein Name: tubulin alpha-3E chain
• Description of Target: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. This gene encodes an alpha tubulin that highly conserved among species. A missense mutation in this gene has been potentially linked to microlissencephaly and global developmental delay.
• Uniprot ID: Q6PEY2
• Protein Accession #: NP_997195
• Protein Size (# AA): 450
• Molecular Weight: 49kDa
• Protein Interactions: NMI; UBC; LGR4; CD81; K3; UBL4A; YWHAE; SUMO1; VHL; TIMM50; PFDN6; AIFM1; VBP1; PFDN5; PFDN4; PFDN2;