Catalog No: ARP53650_P050
Price: $0.00
SKU
ARP53650_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TUBA3C Antibody - N-terminal region (ARP53650_P050)

Datasheets/ManualsPrintable datasheet for anti-TUBA3C (ARP53650_P050) antibody
Product Info
ReferenceJin,J., (2004) Curr. Biol. 14 (16), 1436-1450
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TUBA3C
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL
Concentration0.5 mg/ml
Blocking PeptideFor anti-TUBA3C (ARP53650_P050) antibody is Catalog # AAP53650 (Previous Catalog # AAPP30490)
Sample Type Confirmation

TUBA3C is supported by BioGPS gene expression data to be expressed in HeLa, Jurkat

Enhanced Validation
WBY
SPR
YCHAROS
Gene SymbolTUBA3C
Gene Full NameTubulin, alpha 3c
Alias SymbolsTUBA2, bA408E5.3
NCBI Gene Id7278
Protein NameTubulin alpha-3C/D chain
Description of TargetMicrotubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ13748
Protein Accession #NP_005992
Nucleotide Accession #NM_006001
Protein Size (# AA)450
Molecular Weight50kDa
Protein InteractionsCEP70; UBC; MDM2; CD81; K3; UBL4A; DYNLT1; TSGA10; CUL3; ARRB2; ARRB1; VHL; YWHAQ; DYRK2; YWHAZ; YWHAG; YWHAB; PPP4C; PFDN5; GRM7; NMI; PXN; SIAH1; DYNLL1; TUBG1; MYC; FYN; FBL;
  1. What is the species homology for "TUBA3C Antibody - N-terminal region (ARP53650_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "TUBA3C Antibody - N-terminal region (ARP53650_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TUBA3C Antibody - N-terminal region (ARP53650_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TUBA3C Antibody - N-terminal region (ARP53650_P050)"?

    This target may also be called "TUBA2, bA408E5.3" in publications.

  5. What is the shipping cost for "TUBA3C Antibody - N-terminal region (ARP53650_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TUBA3C Antibody - N-terminal region (ARP53650_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TUBA3C Antibody - N-terminal region (ARP53650_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TUBA3C Antibody - N-terminal region (ARP53650_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TUBA3C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TUBA3C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TUBA3C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TUBA3C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TUBA3C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TUBA3C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TUBA3C Antibody - N-terminal region (ARP53650_P050)
Your Rating
We found other products you might like!