TTRAP Antibody - middle region (ARP33010_P050)

Catalog No: ARP33010_P050

WB Suggested Anti-TTRAP Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateTDP2 is supported by BioGPS gene expression data to be expressed in HepG2

Sample: 1. DT40 (5x10⁵cells)
2. DT40 + rec. hTDP2 (5x10⁵cells)
3. soluble HIS-hTDP2 (5x10⁵cells)
4. pellet HIS-hTDP2 (5x10⁵cells)
Primary dilution:1:1000
Secondary Antibody: dakocytomation Goat anti-rabbit
Secondary dilution: 1:5000
Image Submitted by: Keith Caldecott
University of Sussex 

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TTRAP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TDP2 (ARP33010_P050) antibody is Catalog # AAP33010 (Previous Catalog # AAPP04039)
• Sample Type Confirmation:

  TDP2 is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Pei,H., et al., (2003) Oncogene 22 (18), 2699-2709
• Publications:

  Epigenetic changes in histone acetylation underpin resistance to the topoisomerase I inhibitor irinotecan. Nucleic Acids Res. (2016). 27789688

  Epigenetic changes in histone acetylation underpin resistance to the topoisomerase I inhibitor irinotecan. Nucleic Acids Res. 45, 1159-1176 (2017). 28180300

  Xu, G.-L. et al. TTRAP is a novel PML nuclear bodies-associated protein. Biochem. Biophys. Res. Commun. 375, 395-8 (2008). 18706885

• Description:
  View product citations for TTRAP Antibody - middle region (ARP33010_P050) on CiteAb

Target Info

• Gene Symbol: TDP2
• Gene Full Name: Tyrosyl-DNA phosphodiesterase 2
• Alias Symbols: EAP2, AD022, EAPII, TTRAP, hTDP2, dJ30M3.3
• NCBI Gene Id: 51567
• Protein Name: Tyrosyl-DNA phosphodiesterase 2
• Description of Target: The TTRAP gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors.
• Uniprot ID: O95551
• Protein Accession #: NP_057698
• Nucleotide Accession #: NM_016614
• Protein Size (# AA): 362
• Molecular Weight: 41kDa
• Protein Interactions: UBC; SRPK2; SUMO1; SUMO2; SUMO3; TAP1; SKIL; ATXN1; PSEN1; SMAD3; EPS8; DLX3; ATP5G2; C2orf88; JAM2; SNX13; AKAP9; RAB11A; PARK7; MAPK6; UBE2I; TRAF5; TRAF6; TRAF3; TRAF2; FLI1; TNFRSF1B; ETS2; ETS1; TNFRSF8; CD40; HTNVsSgp1;