TTR Recombinant Protein (Mouse) (OPCA00252)

Catalog No: OPCA00252

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
  Endotoxin Level: < 1.0 EU per 1 ug of the protein by the LAL method.
  Nature: Full Length
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC
• Concentration: 0.1-5 mg/ml (Bradford method)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
• Protein Sequence: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 21-147 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Human-murine transthyretin heterotetramers are kinetically stable and non-amyloidogenic. A lesson in the generation of transgenic models of diseases involving oligomeric proteins.Reixach N., Foss T.R., Santelli E., Pascual J., Kelly J.W., Buxbaum J.N.J. Biol. Chem. 283:2098-2107(2008)
• Warning: For research use only.

Target Info

• Gene Symbol: Ttr
• Gene Full Name: transthyretin
• Alias Symbols: AA408768;AI787086;D17860;prea;prealbumin;transthyretin.
• NCBI Gene Id: 22139
• Protein Name: Transthyretin
• Description of Target: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
• Uniprot ID: P07309
• Protein Size (# AA): Recombinant
• Molecular Weight: 26.6 kDa