Search Antibody, Protein, and ELISA Kit Solutions

TSTA3 Antibody - N-terminal region (ARP58679_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58679_P050-FITC Conjugated

ARP58679_P050-HRP Conjugated

ARP58679_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Tissue specific transplantation antigen P35B
NCBI Gene Id:
Protein Name:
GDP-L-fucose synthase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FX, P35B, SDR4E1
Description of Target:
Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TSTA3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TSTA3.
The immunogen is a synthetic peptide directed towards the N terminal region of human TSTA3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-TSTA3 (ARP58679_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TSTA3 (ARP58679_P050) antibody is Catalog # AAP58679 (Previous Catalog # AAPP35926)
Printable datasheet for anti-TSTA3 (ARP58679_P050) antibody
Sample Type Confirmation:

TSTA3 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HeLa

TSTA3 is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Roos,C., (2002) J. Biol. Chem. 277 (5), 3168-3175

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...