Search Antibody, Protein, and ELISA Kit Solutions

TSSK2 Antibody - middle region (ARP53818_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53818_P050-FITC Conjugated

ARP53818_P050-HRP Conjugated

ARP53818_P050-Biotin Conjugated

Gene Symbol:
TSSK2
Official Gene Full Name:
Testis-specific serine kinase 2
NCBI Gene Id:
23617
Protein Name:
Testis-specific serine/threonine-protein kinase 2
Swissprot Id:
Q96PF2
Protein Accession #:
NP_443732
Nucleotide Accession #:
NM_053006
Alias Symbols:
DGS-G, FLJ38613, SPOGA2, STK22B, TSK2
Replacement Item:
This antibody may replace item sc-100437 from Santa Cruz Biotechnology.
Description of Target:
TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).
Protein Size (# AA):
358
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TSSK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TSSK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TSSK2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-TSSK2 (ARP53818_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SKIV2L; HSP90AA1; ZC3H15; SRRT; SIPA1L1; APP; TSKS; TFG; TSSK2;
Blocking Peptide:
For anti-TSSK2 (ARP53818_P050) antibody is Catalog # AAP53818 (Previous Catalog # AAPP30658)
Datasheets/Manuals:
Printable datasheet for anti-TSSK2 (ARP53818_P050) antibody
Sample Type Confirmation:

TSSK2 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

Target Reference:
Hao,Z., (2004) Mol. Hum. Reprod. 10 (6), 433-444

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...