SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP60913_P050
Price: $0.00
SKU
ARP60913_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP60913_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Horse: 86%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: GCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCL
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP60913
Gene SymbolTSLP
Gene Full NameThymic stromal lymphopoietin
NCBI Gene Id85480
Protein NameThymic stromal lymphopoietin
Description of TargetThis gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Alternative splicing of this gene results in two transcript variants.
Uniprot IDQ969D9
Protein Accession #NP_149024
Nucleotide Accession #NM_033035
Protein Size (# AA)159
Molecular Weight18kDa
Protein InteractionsAPP; PRNP; IKBKG; STAT5A; CRLF2; IL7R; STAT3;
  1. What is the species homology for "TSLP Antibody - C-terminal region (ARP60913_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Horse".

  2. How long will it take to receive "TSLP Antibody - C-terminal region (ARP60913_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TSLP Antibody - C-terminal region (ARP60913_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TSLP Antibody - C-terminal region (ARP60913_P050)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "TSLP Antibody - C-terminal region (ARP60913_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TSLP Antibody - C-terminal region (ARP60913_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TSLP Antibody - C-terminal region (ARP60913_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "18kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TSLP Antibody - C-terminal region (ARP60913_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TSLP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TSLP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TSLP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TSLP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TSLP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TSLP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TSLP Antibody - C-terminal region (ARP60913_P050)
Your Rating
We found other products you might like!