Catalog No: ARP53749_P050
Price: $0.00
SKU
ARP53749_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TSKS (ARP53749_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TSKS
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERS
Concentration0.5 mg/ml
Blocking PeptideFor anti-TSKS (ARP53749_P050) antibody is Catalog # AAP53749 (Previous Catalog # AAPP30840)
ReferenceHao,Z., (2004) Mol. Hum. Reprod. 10 (6), 433-444
Gene SymbolTSKS
Gene Full NameTestis-specific serine kinase substrate
Alias SymbolsTSKS1, TSSKS, STK22S1, PPP1R161
NCBI Gene Id60385
Protein NameTestis-specific serine kinase substrate
Description of TargetTSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the TSKS is highest in the testis and down-regulated in testicular cancer. The gene encoded TSKS is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.
Uniprot IDQ9UJT2
Protein Accession #NP_068379
Nucleotide Accession #NM_021733
Protein Size (# AA)592
Molecular Weight65kDa
Protein InteractionsPPP1CA; SF3A3; SF3A1; USP10; APP; TSSK2;
  1. What is the species homology for "TSKS Antibody - middle region (ARP53749_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "TSKS Antibody - middle region (ARP53749_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TSKS Antibody - middle region (ARP53749_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TSKS Antibody - middle region (ARP53749_P050)"?

    This target may also be called "TSKS1, TSSKS, STK22S1, PPP1R161" in publications.

  5. What is the shipping cost for "TSKS Antibody - middle region (ARP53749_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TSKS Antibody - middle region (ARP53749_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TSKS Antibody - middle region (ARP53749_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TSKS Antibody - middle region (ARP53749_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TSKS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TSKS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TSKS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TSKS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TSKS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TSKS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TSKS Antibody - middle region (ARP53749_P050)
Your Rating
We found other products you might like!