Search Antibody, Protein, and ELISA Kit Solutions

TSEN34 Antibody - C-terminal region : FITC (ARP75754_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75754_P050 Unconjugated

ARP75754_P050-HRP Conjugated

ARP75754_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
tRNA splicing endonuclease subunit 34
NCBI Gene Id:
Protein Name:
tRNA-splicing endonuclease subunit Sen34
Swissprot Id:
Protein Accession #:
Alias Symbols:
Description of Target:
This gene encodes a catalytic subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from precursor tRNAs. The endonuclease complex is also associated with a pre-mRNA 3-prime end processing factor. A mutation in this gene results in the neurological disorder pontocerebellar hypoplasia type 2. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TSEN34.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TSEN34.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEN34
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: PRSALLVQLATARPRPVKARPLDWRVQSKDWPHAGRPAHELRYSIYRDLW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TSEN34 (ARP75754_P050-FITC) antibody is Catalog # AAP75754
Printable datasheet for anti-TSEN34 (ARP75754_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...