TRPV5 Antibody - N-terminal region (ARP49458_P050)

Catalog No: ARP49458_P050

WB Suggested Anti-TRPV5 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateTRPV5 is supported by BioGPS gene expression data to be expressed in 721_B

Sample Type: 1-4. hRetinal pigment epithelial cells, 4 individual donors (20ug)
Primary Dilution: 1:1000
Secondary Antibody: goat anti-rabbit-AP
Secondary Dilution: 1:2000
Image Submitted by: Brian Kennedy
Indiana University Northwest See Customer Feedback tab for detailed information.

Sample Type: hRetinal pigment epithelial cells
Green: primary
Red: nuclear
Primary Dilution: 1:200
Secondary Antibody: goat anti-rabbit-Alexa 488
Secondary Dilution: 1:500
Image Submitted by: Brian Kennedy
Indiana University Northwest See Customer Feedback tab for detailed information.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPV5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 77%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 77%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRPV5 (ARP49458_P050) antibody is Catalog # AAP49458 (Previous Catalog # AAPY02680)
• Sample Type Confirmation:

  TRPV5 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Cha,S.K., Am. J. Physiol. Renal Physiol. 294 (5), F1212-F1221 (2008)

Target Info

• Gene Symbol: TRPV5
• Gene Full Name: Transient receptor potential cation channel, subfamily V, member 5
• Alias Symbols: CAT2, ECAC1, OTRPC3
• NCBI Gene Id: 56302
• Protein Name: Transient receptor potential cation channel subfamily V member 5
• Description of Target: TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2486 AF304464.1 86-2571
• Uniprot ID: Q9NQA5
• Protein Accession #: NP_062815
• Nucleotide Accession #: NM_019841
• Protein Size (# AA): 729
• Molecular Weight: 82kDa
• Protein Interactions: EWSR1; CALB1; S100A10; ANXA2;