Search Antibody, Protein, and ELISA Kit Solutions

Triticum aestivum Recombinant Protein (OPCA03131)

* Required Fields

$0.00
In Stock
Request Bulk Order Quote

Swissprot Id:
P10386
Host:
Triticum aestivum
Molecular Weight:
49 kDa
Product Format:
Liquid
Formulation:
20 mM Tris-HCl based buffer, pH 8.0
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
RCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY
Storage Buffer:
20 mM Tris-HCl based buffer, pH 8.0
Source:
E.coli
Additional Information:
Relevance: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.
Tag:
His-SUMO-tag
Reconstitution and Storage:
Store at -20C. Avoid freeze thaw cycles.
Target Reference:
"Molecular characterization of an active wheat LMW glutenin gene and its relation to other wheat and barley prolamin genes."
Colot V., Bartels D., Thompson R., Flavell R.
Mol. Gen. Genet. 216:81-90(1989)

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...