- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-TRIP13 (ARP38433_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRIP13 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86% |
Peptide Sequence | Synthetic peptide located within the following region: MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-TRIP13 (ARP38433_P050) antibody is Catalog # AAP38433 (Previous Catalog # AAPP20622) |
Sample Type Confirmation | TRIP13 is supported by BioGPS gene expression data to be expressed in HepG2 |
Gene Symbol | TRIP13 |
---|---|
Gene Full Name | Thyroid hormone receptor interactor 13 |
Alias Symbols | MVA3, OOMD9, 16E1BP |
NCBI Gene Id | 9319 |
Protein Name | Pachytene checkpoint protein 2 homolog |
Description of Target | The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. TRIP13 specifically interacts with the ligand binding domain of the TRs. It is a member of Trips (TR-interacting proteins) family. Nearly all of the Trips also show similar ligand-dependent interaction with the retinoid X receptor (RXR), but none interact with the glucocorticoid receptor under any conditions. Trips predict specific functional roles: one is an apparent human homolog of a yeast transcriptional coactivator, one is a new member of a class of nonhistone chromosomal proteins, and one contains a conserved domain associated with ubiquitination of specific target proteins. |
Uniprot ID | Q15645 |
Protein Accession # | NP_004228 |
Nucleotide Accession # | NM_004237 |
Protein Size (# AA) | 432 |
Molecular Weight | 48kDa |
Protein Interactions | KRTAP26-1; KRTAP12-1; KRTAP12-2; MORN3; TEX37; METTL15; MGAT5B; C4orf33; GLYCTK; M1AP; LRR1; LNX1; RHOXF2; LOXL4; ZNF34; FNDC3B; TINAGL1; PBLD; SEMA4G; SPRYD7; PELI1; PLSCR3; PCMTD2; CYB5R2; AMDHD2; TNRC6A; DIP2A; DPYSL4; TRIP13; SIGLEC5; TPT1; SCP2; QARS |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TRIP13 Antibody - N-terminal region (ARP38433_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".
-
How long will it take to receive "TRIP13 Antibody - N-terminal region (ARP38433_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "TRIP13 Antibody - N-terminal region (ARP38433_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TRIP13 Antibody - N-terminal region (ARP38433_P050)"?
This target may also be called "MVA3, OOMD9, 16E1BP" in publications.
-
What is the shipping cost for "TRIP13 Antibody - N-terminal region (ARP38433_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TRIP13 Antibody - N-terminal region (ARP38433_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TRIP13 Antibody - N-terminal region (ARP38433_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "48kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TRIP13 Antibody - N-terminal region (ARP38433_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TRIP13"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TRIP13"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TRIP13"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TRIP13"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TRIP13"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TRIP13"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.