Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

TRIM49 Antibody - N-terminal region : FITC (ARP72353_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72353_P050 Unconjugated

ARP72353_P050-HRP Conjugated

ARP72353_P050-Biotin Conjugated

Gene Symbol:
TRIM49
NCBI Gene Id:
57093
Swissprot Id:
P0CI25
Protein Accession #:
NP_065091
Alias Symbols:
TRIM49, RNF18,
Replacement Item:
This antibody may replace item sc-100884 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This gene has been found to be preferentially expressed in testis. Related pseudogenes and gene duplicates have also been identified on chromosome 11.
Protein Size (# AA):
452
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRIM49.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRIM49.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRIM49
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETKKI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
BLM; HSP90AA1;
Blocking Peptide:
For anti-TRIM49 (ARP72353_P050-FITC) antibody is Catalog # AAP72353
Datasheets/Manuals:
Printable datasheet for anti-TRIM49 (ARP72353_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...