Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TRIM32 antibody - N-terminal region (ARP38965_T100)

100 ul
In Stock

Conjugation Options

ARP38965_T100-FITC Conjugated

ARP38965_T100-HRP Conjugated

ARP38965_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Tripartite motif containing 32
Protein Name:
E3 ubiquitin-protein ligase TRIM32
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-134120 from Santa Cruz Biotechnology.
Description of Target:
TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRIM32.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRIM32.
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM32
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-TRIM32 (ARP38965_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TRIM32 (ARP38965_T100) antibody is Catalog # AAP38965 (Previous Catalog # AAPY00774)
Printable datasheet for anti-TRIM32 (ARP38965_T100) antibody
Target Reference:
Chiang,A.P., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (16), 6287-6292

Kudryashova, E., Wu, J., Havton, L. A. & Spencer, M. J. Deficiency of the E3 ubiquitin ligase TRIM32 in mice leads to a myopathy with a neurogenic component. Hum. Mol. Genet. 18, 1353-67 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19155210

Streich, F. C., Ronchi, V. P., Connick, J. P. & Haas, A. L. Tripartite motif ligases catalyze polyubiquitin chain formation through a cooperative allosteric mechanism. J. Biol. Chem. 288, 8209-21 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23408431

Tell us what you think about this item!

Write A Review
    Please, wait...