Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TRIM32 antibody - C-terminal region (ARP38966_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP38966_T100-FITC Conjugated

ARP38966_T100-HRP Conjugated

ARP38966_T100-Biotin Conjugated

Gene Symbol:
TRIM32
NCBI Gene Id:
22954
Official Gene Full Name:
Tripartite motif containing 32
Protein Name:
E3 ubiquitin-protein ligase TRIM32
Swissprot Id:
Q13049
Protein Accession #:
NP_036342
Nucleotide Accession #:
NM_012210
Alias Symbols:
BBS11, HT2A, LGMD2H, TATIP
Replacement Item:
This antibody may replace item sc-134120 from Santa Cruz Biotechnology.
Description of Target:
TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Protein Size (# AA):
653
Molecular Weight:
72kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRIM32.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRIM32.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM32
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Complete computational species homology data:
Anti-TRIM32 (ARP38966_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PTPN11; PDE9A; PTCD2; CLIP4; KCTD9; UBQLN1; TRIM32; RABAC1; ABI2; SCGB1A1; UBE2E1; UBE2D1; UBC; TP53; SDCBP; UBE2U; SYT6; MYCN; CEP250; CUL3; GPRASP2; GLIS2; YWHAB; TP73; UBE2D3; UBE2D2; HSP90AA1; SFN; YWHAQ; YWHAZ; YWHAH; YWHAG; YWHAE; NOTCH1; UBD; TOP1;
Blocking Peptide:
For anti-TRIM32 (ARP38966_T100) antibody is Catalog # AAP38966 (Previous Catalog # AAPY00775)
Datasheets/Manuals:
Printable datasheet for anti-TRIM32 (ARP38966_T100) antibody
Sample Type Confirmation:

TRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T

Additional Information:
IHC Information: Transfected 293T cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Target Reference:
Chiang,A.P., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (16), 6287-6292

Tell us what you think about this item!

Write A Review
    Please, wait...