TRIM21 Recombinant Protein (Mouse) (OPCA02306)

Catalog No: OPCA02306

Trim21 Recombinant Protein (Mouse) (OPCA02306) in SDS-PAGE showing the molecular weight of approximately 70.14 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Lyophilized 10mM Tris-HCl, 1mM EDTA, 6% Trehalose (pH 8.0)
• Host: Mouse
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Full Length: MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM
• Source: E.coli
• Protein Range: 1-470 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Structural differences between the human and mouse 52-kD Ro autoantigens associated with poorly conserved autoantibody activity across species.Keech C.L., Gordon T.P., McCluskey J.Clin. Exp. Immunol. 104:255-263(1996)
• Gene Symbol: TRIM21
• Alias Symbols: 52 kDa ribonucleoprotein autoantigen Ro/SS-A;52 kDa Ro protein;RING-type E3 ubiquitin transferase TRIM21;Ro(SS-A);Sjoegren syndrome type A antigen;Tripartite motif-containing protein 21.
• Protein Name: E3 ubiquitin-protein ligase TRIM21
• Description of Target: E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)-like complex is shown to mediate ubiquitination of CDKN1B ('Thr-187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs.2. Involved in the regulation of innate immunity and the inflammatory response in response to IFNG/IFN-gamma. Organizes autophagic machinery by serving as a platform for the assembly of ULK1, Beclin 1/BECN1 and ATG8 family members and recognizes specific autophagy targets, thus coordinating target recognition with assembly of the autophagic apparatus and initiation of autophagy. Acts as an autophagy receptor for the degradation of IRF3, hence attenuating type I interferon (IFN)-dependent immune responses (By similarity).
• Uniprot ID: Q62191
• Protein Size (# AA): Recombinant
• Molecular Weight: 70.2 kDa