TRIM21 Antibody - C-terminal region (ARP38248_T100)

Catalog No: ARP38248_T100

WB Suggested Anti-TRIM21 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T

Host: Rabbit
Target Name: TRIM21
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 5ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Guinea Pig, Horse, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM21
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Pig: 85%; Rat: 77%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-TRIM21 (ARP38248_T100) antibody is Catalog # AAP38248 (Previous Catalog # AAPP23102)
• Reference: Yamochi,T., (2008) Biochem. Biophys. Res. Commun. 370 (1), 195-199

Target Info

• Gene Symbol: TRIM21
• Gene Full Name: Tripartite motif containing 21
• Alias Symbols: SSA, RO52, SSA1, RNF81, Ro/SSA
• NCBI Gene Id: 6737
• Protein Name: E3 ubiquitin-protein ligase TRIM21
• Description of Target: TRIM21 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM21 is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P19474
• Protein Accession #: NP_003132
• Nucleotide Accession #: NM_003141
• Protein Size (# AA): 475
• Molecular Weight: 54kDa
• Protein Interactions: TRIM39; IGHV4-31; TXN2; GRAP; UBE2I; TRIM21; IGHG1; USP15; HAUS2; UBE2D2; UBC; FBXO6; UBD; NPM1; PAN2; ROR1; NOS2; MYC; IQCB1; USP2; VCP; USP4; CDC34; CBL; UBC4; UBE2C; UBE2L3; UBE2H; UBE2D1; TROVE2; TRIM27; MNAT1; FCGR2A; CD52; DCP2; ZFPM1; TRIM5; TRIM8;