TRIM16 Antibody - N-terminal region (ARP35802_P050)

Catalog No: ARP35802_P050

WB Suggested Anti-TRIM16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM16
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: AELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRIM16 (ARP35802_P050) antibody is Catalog # AAP35802 (Previous Catalog # AAPP07054)
• Reference: Munding,C., (2006) Cell Death Differ. 13 (11), 1938-1949

Target Info

• Gene Symbol: TRIM16
• Gene Full Name: Tripartite motif containing 16
• Alias Symbols: EBBP
• NCBI Gene Id: 10626
• Protein Name: Tripartite motif-containing protein 16
• Description of Target: This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. TRIM16 contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Its function, however, has not yet been determined.This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined. This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined.
• Uniprot ID: O95361
• Protein Accession #: NP_006461
• Nucleotide Accession #: NM_006470
• Protein Size (# AA): 564
• Molecular Weight: 64kDa
• Protein Interactions: HSP90AB2P; CLUH; TOMM34; MCM7; UBC; APP; ACD; TINF2; POT1; TERF1; VIM; E2F1; SETDB1;