TRIM10 Antibody - N-terminal region (ARP34706_P050)

Catalog No: ARP34706_P050

WB Suggested Anti-TRIM10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysateThere is BioGPS gene expression data showing that TRIM10 is expressed in PANC1

WB Suggested Anti-TRIM10 antibody Titration: 1 ug/mL
Sample Type: Human heart

WB Suggested Anti-TRIM10 antibody Titration: 1 ug/mL
Sample Type: Human liver

Rabbit Anti-TRIM10 Antibody
Catalog Number: ARP34706_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM10
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRIM10 (ARP34706_P050) antibody is Catalog # AAP34706 (Previous Catalog # AAPP23654)
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that TRIM10 is expressed in PANC1

Target Info

• Reference: Shiina,T., (2006) Genetics 173 (3), 1555-1570
• Gene Symbol: TRIM10
• Gene Full Name: Tripartite motif containing 10
• Alias Symbols: RNF9, HERF1, RFB30
• NCBI Gene Id: 10107
• Protein Name: Tripartite motif-containing protein 10
• Description of Target: TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that t
• Uniprot ID: Q9UDY6
• Protein Accession #: NP_006769
• Nucleotide Accession #: NM_006778
• Protein Size (# AA): 481
• Molecular Weight: 55kDa
• Protein Interactions: TTC23; ZNF148; PSMA1; PRKAB2; HSP90AA1; UBE2D4; UBE2D3; UBE2D2; UBE2D1; TRIM10;