TRIB2 Antibody - middle region (ARP55377_P050)

Catalog No: ARP55377_P050

WB Suggested Anti-TRIB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIB2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRIB2 (ARP55377_P050) antibody is Catalog # AAP55377 (Previous Catalog # AAPP33249)

Target Info

• Reference: Lin,K.R., (2007) J. Biol. Chem. 282 (30), 21962-21972
• Gene Symbol: TRIB2
• Gene Full Name: Tribbles homolog 2 (Drosophila)
• Alias Symbols: C5FW, TRB2, GS3955
• NCBI Gene Id: 28951
• Protein Name: Tribbles homolog 2
• Description of Target: TRIB2 is one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia.
• Uniprot ID: Q92519
• Protein Accession #: NP_067675
• Nucleotide Accession #: NM_021643
• Protein Size (# AA): 343
• Molecular Weight: 39kDa
• Protein Interactions: RFWD2; SMURF1; BTRC; PRMT6; UBC; RPS6KB1; SLAMF7; APP; UBQLN4;