Search Antibody, Protein, and ELISA Kit Solutions

TRIB1 Antibody - middle region (ARP52412_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52412_P050-FITC Conjugated

ARP52412_P050-HRP Conjugated

ARP52412_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Tribbles homolog 1 (Drosophila)
NCBI Gene Id:
Protein Name:
Tribbles homolog 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-367216 from Santa Cruz Biotechnology.
Description of Target:
TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRIB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRIB1.
The immunogen is a synthetic peptide directed towards the middle region of human TRIB1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
Complete computational species homology data:
Anti-TRIB1 (ARP52412_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TRIB1 (ARP52412_P050) antibody is Catalog # AAP52412 (Previous Catalog # AAPS31611)
Printable datasheet for anti-TRIB1 (ARP52412_P050) antibody
Sample Type Confirmation:

TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205

Target Reference:
Kathiresan,S., (2008) Nat. Genet. 40 (2), 189-197

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...