Catalog No: AVARP00012_T100
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TRAP1 (AVARP00012_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TRAP1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 85%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: AQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEF
Concentration1.0 mg/ml
Blocking PeptideFor anti-TRAP1 (AVARP00012_T100) antibody is Catalog # AAP30183 (Previous Catalog # AAPS31003)
Sample Type Confirmation

TRAP1 is supported by BioGPS gene expression data to be expressed in HepG2

ReferenceMasuda,Y., et al., (2004) J. Biol. Chem. 279 (41), 42503-42515 -2004 (41), 42503-42515
Gene SymbolTRAP1
Gene Full NameTNF receptor-associated protein 1
Alias SymbolsHSP75, HSP 75, HSP90L, TRAP-1
NCBI Gene Id10131
Protein NameHeat shock protein 75 kDa, mitochondrial
Description of TargetSuppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
Uniprot IDQ12931
Protein Accession #NP_057376
Nucleotide Accession #NM_016292
Protein Size (# AA)704
Molecular Weight80kDa
  1. What is the species homology for "TRAP1 Antibody - N-terminal region (AVARP00012_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig".

  2. How long will it take to receive "TRAP1 Antibody - N-terminal region (AVARP00012_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TRAP1 Antibody - N-terminal region (AVARP00012_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TRAP1 Antibody - N-terminal region (AVARP00012_T100)"?

    This target may also be called "HSP75, HSP 75, HSP90L, TRAP-1" in publications.

  5. What is the shipping cost for "TRAP1 Antibody - N-terminal region (AVARP00012_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TRAP1 Antibody - N-terminal region (AVARP00012_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TRAP1 Antibody - N-terminal region (AVARP00012_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "80kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TRAP1 Antibody - N-terminal region (AVARP00012_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TRAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TRAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TRAP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TRAP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TRAP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TRAP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TRAP1 Antibody - N-terminal region (AVARP00012_T100)
Your Rating
We found other products you might like!