Search Antibody, Protein, and ELISA Kit Solutions

TRAF6 Antibody - middle region (ARP88924_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
TRAF6
Official Gene Full Name:
TNF receptor-associated factor 6
NCBI Gene Id:
22034
Protein Name:
TNF receptor-associated factor 6
Swissprot Id:
P70196
Protein Accession #:
NP_001290202.1
Nucleotide Accession #:
NM_001303273.1
Alias Symbols:
AI851288, 2310003F17Rik, C630032O20Rik
Description of Target:
This gene encodes a member of the TNF receptor associated factor (TRAF) family of adaptor proteins that mediate signaling events from members of the TNF receptor and Toll/IL-1 receptor families to activate transcription factors such as NF-kappa-B and AP-1. The product of this gene is essential for perinatal and postnatal survival. Mice deficient in this protein exhibit osteopetrosis and defective in development of epidermal appendixes, normal B cell differentiation, lymph node organogenesis, interleukin-1 signaling, lipopolysaccharide signaling and neural tube closure. This protein possesses ubiquitin ligase activity. Alternate splicing of this gene results in multiple transcript variants.
Protein Size (# AA):
530
Molecular Weight:
58 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRAF6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRAF6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse TRAF6
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: MRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TRAF6 (ARP88924_P050) antibody is Catalog # AAP88924
Datasheets/Manuals:
Printable datasheet for anti-TRAF6 (ARP88924_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...