TRAF5 Antibody - C-terminal region : Biotin (ARP75163_P050-Biotin)

Catalog No: ARP75163_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAF5
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRAF5 (ARP75163_P050-Biotin) antibody is Catalog # AAP75163
• Reference: N/A

Target Info

• Gene Symbol: TRAF5
• Alias Symbols: RNF84, MGC:39780
• NCBI Gene Id: 7188
• Description of Target: The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Alternate transcriptional splice variants have been characterized.
• Uniprot ID: O00463
• Protein Accession #: NP_665702
• Protein Size (# AA): 557
• Molecular Weight: 61kDa