Search Antibody, Protein, and ELISA Kit Solutions

TRAF5 Antibody - C-terminal region (ARP75163_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75163_P050-FITC Conjugated

ARP75163_P050-HRP Conjugated

ARP75163_P050-Biotin Conjugated

Gene Symbol:
TRAF5
NCBI Gene Id:
7188
Swissprot Id:
O00463
Protein Accession #:
NP_665702
Alias Symbols:
TRAF5, RNF84,
Replacement Item:
This antibody may replace item sc-133252 from Santa Cruz Biotechnology.
Description of Target:
The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Alternate transcriptional splice variants have been characterized.
Protein Size (# AA):
557
Molecular Weight:
61kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRAF5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRAF5.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAF5
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human, Mouse
Peptide Sequence:
Synthetic peptide located within the following region: RQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TRAF5 (ARP75163_P050) antibody is Catalog # AAP75163
Datasheets/Manuals:
Printable datasheet for anti-TRAF5 (ARP75163_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...