Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

TRAF3 Antibody - C-terminal region : FITC (ARP75162_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75162_P050 Unconjugated

ARP75162_P050-HRP Conjugated

ARP75162_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1574 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRAF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRAF3.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAF3
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: SRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Blocking Peptide:
For anti-TRAF3 (ARP75162_P050-FITC) antibody is Catalog # AAP75162
Printable datasheet for anti-TRAF3 (ARP75162_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...