SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: AVARP09008_P050-FITC
Size:100ul
Price: $434.00
SKU
AVARP09008_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-TRAF1 (AVARP09008_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TRAF1
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 84%
Peptide SequenceSynthetic peptide located within the following region: DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK
Concentration0.5 mg/ml
Blocking PeptideFor anti-TRAF1 (AVARP09008_P050-FITC) antibody is Catalog # AAP30221 (Previous Catalog # AAPP00378)
Reference(2008) Genes Immun. 9 (4), 379-382
Gene SymbolTRAF1
Gene Full NameTNF receptor-associated factor 1
Alias SymbolsEBI6, MGC:10353
NCBI Gene Id7185
Protein NameTNF receptor-associated factor 1
Description of TargetThis protein is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors.The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ13077
Protein Accession #NP_005649
Nucleotide Accession #NM_005658
Protein Size (# AA)416
Molecular Weight46kDa
Protein InteractionsZNF662; KLHL38; TRIM42; RTP5; SSC5D; MORN3; POM121L4P; OLIG3; CCDC116; ZNF564; SLC25A48; ALS2CR11; LOC149950; ZNF417; TMC8; ZNF572; RBM45; C1orf216; ZNF440; TBC1D16; HAUS1; SYCE1; ZNF502; C5orf30; CCDC120; FBF1; ZNF587; BEX2; LCOR; FAM161A; PLEKHN1; RASSF
  1. What is the species homology for "TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)"?

    This target may also be called "EBI6, MGC:10353" in publications.

  5. What is the shipping cost for "TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TRAF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TRAF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TRAF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TRAF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TRAF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TRAF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TRAF1 Antibody - middle region : FITC (AVARP09008_P050-FITC)
Your Rating
We found other products you might like!