Search Antibody, Protein, and ELISA Kit Solutions

TRAF1 Antibody - middle region (AVARP09008_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

AVARP09008_P050-FITC Conjugated

AVARP09008_P050-HRP Conjugated

AVARP09008_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
TRAF1
Official Gene Full Name:
TNF receptor-associated factor 1
NCBI Gene Id:
7185
Protein Name:
TNF receptor-associated factor 1
Swissprot Id:
Q13077
Protein Accession #:
NP_005649
Nucleotide Accession #:
NM_005658
Alias Symbols:
EBI6, MGC:10353
Replacement Item:
This antibody may replace item sc-1830 from Santa Cruz Biotechnology.
Description of Target:
This protein is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors.The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
416
Molecular Weight:
46kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRAF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRAF1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TRAF1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 84%
Complete computational species homology data:
Anti-TRAF1 (AVARP09008_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ZNF662; KLHL38; TRIM42; RTP5; SSC5D; MORN3; POM121L4P; OLIG3; CCDC116; ZNF564; SLC25A48; ALS2CR11; LOC149950; ZNF417; TMC8; ZNF572; RBM45; C1orf216; ZNF440; TBC1D16; HAUS1; SYCE1; ZNF502; C5orf30; CCDC120; FBF1; ZNF587; BEX2; LCOR; FAM161A; PLEKHN1; RASSF
Blocking Peptide:
For anti-TRAF1 (AVARP09008_P050) antibody is Catalog # AAP30221 (Previous Catalog # AAPP00378)
Datasheets/Manuals:
Printable datasheet for anti-TRAF1 (AVARP09008_P050) antibody
Target Reference:
(2008) Genes Immun. 9 (4), 379-382

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...