TRADD Antibody - N-terminal region (ARP87010_P050)

Catalog No: ARP87010_P050

Host: Rabbit
Target Name: TRADD
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRADD
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: AAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRADD (ARP87010_P050) antibody is Catalog # AAP87010

Target Info

• Gene Symbol: TRADD
• Gene Full Name: TNFRSF1A associated via death domain
• Alias Symbols: Hs.89862
• NCBI Gene Id: 8717
• Protein Name: Tumor necrosis factor receptor type 1-associated DEATH domain protein
• Description of Target: The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway.
• Uniprot ID: Q15628
• Protein Accession #: NP_001310481.1
• Nucleotide Accession #: NM_001323552.1
• Protein Size (# AA): 312
• Molecular Weight: 34 kDa